Deuteronomy 1:11 (King James Version)
יהוה אלהי אבותכם יסף עליכם ככם אלף פעמים ויברך אתכם כאשר דבר לכם׃
11(The LORD God of your fathers make you a thousand times so many more as ye are, and bless you, as he hath promised you!)

Geneva Study Bible

(The LORD God of your fathers make you a thousand times so many more as ye are, and bless you, as he hath promised you!) Deuteronomy One: Eleven 1:11 1:11
יהוה אלהי אבותכם יסף עליכם ככם אלף פעמים ויברך אתכם כאשר דבר לכם׃
Matthew Henry's Concise Commentary

1:9-18 Moses reminds the people of the happy constitution of their government, which might make them all safe and easy, if it was not their own fault. He owns the fulfilment of God's promise to Abraham, and prays for the further accomplishment of it. We are not straitened in the power and goodness of God; why should we be straitened in our own faith and hope? Good laws were given to the Israelites, and good men were to see to the execution of them, which showed God's goodness to them, and the care of Moses.



Deuteronomy 11:1 (King James Version)

ואהבת את יהוה אלהיך ושמרת משמרתו וחקתיו ומשפטיו ומצותיו כל־הימים׃
1Therefore thou shalt love the LORD thy God, and keep his charge, and his statutes, and his judgments, and his commandments, alway.


Geneva Study Bible
ואהבת את יהוה אלהיך ושמרת משמרתו וחקתיו ומשפטיו ומצותיו כל־הימים׃
Therefore thou shalt love the LORD thy God, and keep his charge, and his statutes, and his judgments, and his commandments, alway.

Jamieson-Fausset-Brown Bible Commentary

CHAPTER 11

De 11:1-32. An Exhortation to Obedience.

1. Therefore thou shalt love the Lord thy God, and keep his charge—The reason for the frequent repetition of the same or similar counsels is to be traced to the infantine character and state of the church, which required line upon line and precept upon precept. Besides, the Israelites were a headstrong and perverse people, impatient of control, prone to rebellion, and, from their long stay in Egypt, so violently addicted to idolatry, that they ran imminent risk of being seduced by the religion of the country to which they were going, which, in its characteristic features, bore a strong resemblance to that of the country they had left.

Matthew Henry's Concise Commentary

11:1-7 Observe the connexion of these two; Thou shalt love the Lord, and keep his charge. Love will work in obedience, and that only is acceptable obedience which flows from a principle of love, 1Jo 5:3. Moses recounts some of the great and terrible works of God which their eyes had seen. What our eyes have seen, especially in our early days, should affect us, and make us better long afterwards.




Deuteronomy 11:11 King James Bible

והארץ אשר אתם עברים שמה לרשתה ארץ הרים ובקעת למטר השמים תשתה־מים׃
But the land, whither ye go to possess it, is a land of hills and valleys, and drinketh water of the rain of heaven:



Geneva Study Bible

But the land, whither ye go to possess it, is a land of hills and valleys, and drinketh water of the rain of heaven:
והארץ אשר אתם עברים שמה לרשתה ארץ הרים ובקעת למטר השמים תשתה־מים׃
Wesley's Notes

11:11 Of hills and valleys - And therefore much more healthful than Egypt was, which as it was enriched, so it was annoyed with the Nile, which overflowed the land in summer time, and thereby made the country both unpleasant and unhealthful. And health being the greatest of all outward blessings, Canaan must therefore needs be a more desirable habitation than Egypt. The rain of heaven - Which is more easy, being given thee without thy charge or pains; more sweet and pleasant, not hindering thy going abroad upon thy occasions, as the overflow of the Nile did, whereby the Egyptians were confined in a great measure to their houses; more safe and healthful, being free from that mud which attends upon the waters of the Nile; and more certain too, the former and the latter rain being promised to be given to them in their several seasons, upon condition of their obedience, which condition, tho' it may seem a clog and inconvenience, yet indeed was a great benefit, that by their own necessities and interest they might be obliged to that obedience, upon which their happiness depended both for this life and the next.

Matthew Henry's Concise Commentary

11:8-17 Moses sets before them, for the future, life and death, the blessing and the curse, according as they did or did not keep God's commandment. Sin tends to shorten the days of all men, and to shorten the days of a people's prosperity. God will bless them with an abundance of all good things, if they would love him and serve him. Godliness has the promise of the life that now is; but the favour of God shall put gladness into the heart, more than the increase of corn, and wine, and oil. Revolt from God to idols would certainly be their ruin. Take heed that your hearts be not deceived. All who forsake God to set their affection upon any creature, will find themselves wretchedly deceived, to their own destruction; and this will make it worse, that it was for want of taking heed.




שמע ישראל יהוה אלהינו יהוה ׀ אחד ׃

We should keep in mind that the number divisions in the bible (i.e., chapters and verses) were invented long after the Old and New Testaments were written.

As a matter of fact, the Old Testament, and maybe even the New, did not as much as have spaces between words!

Very true, no vowels either and possibly no spaces.
The source for the Torah and Tanach (Torah, Prophets and the Writings) having no spaces is
the Kabbalistic Rabbinic writings (you may have another source .. if so please don't hesitate).
In the Museum of the Scroll in Israel (where the Isaiah fragments are) the whole history of the
"Old" Testament (First Testament) is outlined and there are Torah scrolls there. All of them have
spaces between the words. There is no scroll without spaces between the words that has ever
been archeologically discovered.

So the explanation for there being no spaces comes from Rabbinic sources ....
http://ohr.edu/ask_db/ask_main.php/121/Q1/
http://www.myjewishlearning.com/texts/Week...ronfman5762.htm

Bible Code
Codes, Computers and Critics

" In The Bible Code, Michael Drosnin makes the claim that "there is a Bible beneath the Bible… criss-crossing the entire known text of the Bible, hidden under the original Hebrew of the Old Testament, is a complex network of words and phrases, a new revelation" (The Bible Code, p. 25). To find the Bible code, he mentions that researchers "eliminated all the spaces between the words, and turned the entire original Bible into one continuous letter sequence, 304,805 letters long" (Ibid.). Computers were then programmed to search for words by looking at letters at various intervals—every second, fifth, 100th or 1,000th letter, etc." ....

http://www.lcg.org/cgi-bin/lcg/studytopics...item=1116550257




In any case, what we as born again believers have in the First and Second ('old' and 'new) Testaments is the authoritative God inspired scripture/word of God, with understandable 'separated' words which instruct us, comprehensively and unambiguously into the way of salvation.



2 Pet 1:19 We have also a more sure word of prophecy; whereunto ye do well that ye take heed, as unto a light that shineth in a dark place, until the day dawn, and the day star arise in your hearts:
2 Pet 1:20 Knowing this first, that no prophecy of the scripture is of any private interpretation.
2 Pet 1:21 For the prophecy came not in old time by the will of man: but holy men of God spake as they were moved by the Holy Ghost.

Just because there were no spaces does not mean that it was confusing. That is simply the way they wrote back 3000-years ago. They would read it as well as we could. It is just a matter of getting used to it.

The Dead Sea Scrolls are just copies of the originals. They are still 200 to 1100 years after the originals (from Moses to Nehemiah). It was primarily the post exilic writings that I had in mind, that is, before 586 BC.

Below is an example where one can see with their own eyes that at least ancient Greek (at least sometimes, if not always) did not have spaces between words. This is true of many languages, and it only makes sense that this was true of anceint Hebrew as well.

The main point of this discussion, though, is just to remind us that chapters and verses in the bible came long after the bible was written and are therefore are not inspired. This is true of the way we group our bible into 66 books. And this is even true of the spaces even between the words.



See http://www.rain.org/~mkummel/stumpers/15feb02a.html for an easy-to-read article on this subject.

-quote-

"that chapters and verses in the bible came long after the bible was written and are therefore are not inspired"



http://www.av1611.org/othpubls/eleven.html

-excerpt-

" Somebody's probably thinking. . . Whoa! Just a minute. . . The chapter and verse numbers aren't "inspired" — there are no chapter and verse numbers in the "original Hebrew" manuscripts! So that eliminates any chapter/verse number "meanings".

If the chapters and numbers for the verses aren't "inspired" — are the "vowels" and "spaces"? There are no vowels, spaces or lower case letters in the "original Hebrew" text. (also the Hebrew text read left to right).

If only the "original Hebrew" manuscript is inspired, etc. — let's remove the spaces, vowels and lower case letters from the Old Testament! By doing so, can you read the following chapter?

SLMFDVDTHLRDSMYSHPHRDSHLLNTWNTHMK
THMTLDWNNGRNPSTRSHLDTHMBSDTHSTLLW
TRSHRSTRTHMYSLHLDTHMNTHPTHSFRGHTS
NSSFRHSNMSSKYTHGHWLKTHRGHTHVLLYFT
HSHDWFDTHWLLFRNVLFRTHRTWTHMTHYRDN
DTHYSTFFTHYCMFRTMTHPRPRSTTBLBFRMN
THPRSNCFMNNMSTHNNTSTMYHDWTHLMYCPR
NNTHVRSRLYGDNSSNDMRCYSHLLFLLWMLLT
HDYSFMYLFNDWLLDWLLNTHHSFTHLRDFRVR

Have we settled that?
Are we ready to proceed?
Thank you. . . ;-) ................. "







*******************************
http://www.av1611.org/othpubls/eleven.html

The Mysterious 11 and the World Trade Center Bombing
Terry Watkins Dial-the-Truth Ministries

NOTE: The purpose of this article is intended in no way to trivialize, diminish, or discount the terrible tragedy that took place on September 11, 2001. Our hearts and prayers go out to the thousands of parents, husbands, wives, children and friends whose loved ones were senselessly and unmercifully murdered.

Neither is it intended to be a condemnation or judgement of America. As a proud American, I love my country, and consider it the greatest nation on earth.

This article is an examination of a phenomenon in the light of the Bible, God’s Word.

On Tuesday, September 11, 2001, the worst tragedy in the history of the United States occurred, as American Airlines Flight 11 bombed into the World Twin Tower. As authorities were frantically searching for what went wrong on Flight 11, just 55 minutes later, like a speeding missile, with 92 innocent people, American Airlines Flight 77 exploded through Twin Towers number two. No one who has seen the TV scenes of the airplanes turned deadly missile exploding into the Trade Center, full of innocent victims, can ever be the same.

Our country was shattered. . .

Our lives were shattered. . .

For many, their loved ones and dreams were shattered. . .

In such a terrible and senseless tragedy, it’s only natural to search for some possible "hidden" meaning. Is there a deeper reason for such a tragedy? Is God trying to get America’s attention? Why did God allow something so evil to happen? Could something so devastating, so evil, so senseless, happen and God not have something to say?

Many people have emailed about the numerous occurrences of the number "eleven" found in the disastrous events associated with the September 11th World Trade Center Bombing.

# The day of the attack: 11
# The Date of the Attack, Spetember 11 or 9/11 = 9 + 1 + 1 = 11
# 911 is emergency number = 9 + 1 + 1 = 11
# September 11th is the 254th day of the year: 2 + 5 + 4 = 11
# After September 11th we have 111 remaining for the end of the year.
# 119 is the Area Code for Iran & Iraq 1 + 1+ 9 = 11
# The first plane to hit one of the buildings was Flight 11
# The State of New York was the 11th State to join the Union
# New York City = 11 letters
# Afghanistan = 11 letters
# The Pentagon = 11 letters
# Flight 11 had 92 passengers, 9 + 2 = 11
# Flight 77 had 65 passengers, 6 + 5 = 11
# Twin Towers look like an 11
# Twin Towers had 110 floors

Another sad occurence of the number 9 and 11 is found in the official number of people killed in the World Twin Towers: 2792.

# 2 + 7 = 9
# 9 + 2 = 11
# 27 + 92 = 119
# 92 - 27 = 65 = 6 + 5 = 11

Does the repeatedly occurrences of the number eleven have a deeper meaning?

Or are they just a weird coincident?

Note. There is also another unusual occurrences of another number that we’ll look at later.

As any serious Bible student knows, God has specific meanings for certain numbers. Several books have been written about the Bible and numbers, such as, Biblical Mathematics by Ed. F. Vallowe, Bible Numerics by Dr. Peter S. Ruckman, Number in Scripture by E.W. Bullinger, Numbers in the Bible by Robert D. Johnston, and Triskaidekaphodia - The Fear Of The Number 13 by Dr. Paul Heaton.

Bulllinger, writes in his excellent book, Number in Scripture:

"The question which we have to answer is--Is number used with design or by chance? Surely if God uses it, it must be with infinite wisdom and with glorious perfection. And so it is. Each number has its own significance . . . Numbers, . . . and their secrets, hold an important place in the words as well as in the works of God. . ."
(E.W. Bullinger, Number in Scripture, pp. 20-21)

Ed Vallowe, writes in Biblical Mathematics:

"If the Bible is an inspired Book as it claims to be, are not its numbers as well as its words inspired? One of its books is called 'Numbers'. . . One out of every five Scriptures in the Bible contains a number. . .The Bible is a book from beginning to end that is built upon a vast system of numbers which is interwoven with the doctrines of the Word of God."
(Ed F. Vallowe, Biblical Mathematics, p. 20)

One example of the Bible's unique meanings to numbers, is the dreaded number 666 – the mark of the Beast, mentioned in Revelation 13:18.

Here is wisdom. Let him that hath understanding count the number of the beast: for it is the number of a man; and his number is Six hundred threescore and six. Revelation 13:18

The Bible clearly associated the number SIX with man. Rev. 13:18 reads ". ..for it is the number of a man. . "

This number-six-man correlation is found throughout the Bible.

Man was created on the SIXTH day:

And God said, Let us make MAN in our image, after our likeness: and let them have dominion over the fish of the sea, and over the fowl of the air, and over the cattle, and over all the earth, and over every creeping thing that creepeth upon the earth.
So God created man in his own image, in the image of God created he him; male and female created he them. . . .
And God saw every thing that he had made, and, behold, it was very good. And the evening and the morning were the SIXTH day. (Gen. 1:26, 27, 31)

SIX days for MAN to labour.

SIX days shalt thou labour, and do all thy work:
But the seventh day is the sabbath of the LORD thy God: in it thou shalt not do any work, thou, nor thy son, nor thy daughter, thy manservant, nor thy maidservant, nor thy cattle, nor thy stranger that is within thy gates: (Exodus 20:9, 10)

SIX days belonged to MAN, but the seventh to the Lord.

MAN could sow the land SIX years, but the seventh belonged to the Lord..

SIX years thou shalt sow thy field, and six years thou shalt prune thy vineyard, and gather in the fruit thereof;
But in the seventh year shall be a sabbath of rest unto the land, a sabbath for the LORD: thou shalt neither sow thy field, nor prune thy vineyard. (Leviticus 25:3,4)

SIX years the land belonged to MAN, but the seventh was the Lords’.

Why? SIX belongs to MAN.
There are SIXTY-SIX books of the Bible. The Bible is God’s message for MAN.
The word MAN occurs SIX times in Genesis chapter SIX. (verses 3,5,6, 2 times in 7, 9)
The word MAN occurs SIX times in II Chronicles chapter SIX. (verses 5,16,22,29,30,36)
The word MAN occurs SIX times in Galatians chapter SIX. (verses 1,3,4,5,7,17)
There are seven dispensations in the Bible. MAN is in control of SIX. The seventh dispensation (the millenium) the Lord is in control.

The seven dispensations are:
1 Innocence - from the creation to the fall – MAN’s
2 Conscience - from the fall to the Flood – MAN’s
3 Human Government - from the Flood to the call of Abraham – MAN’s
4 Promise - from the call of Abraham to the giving of the Law at Sinai under Moses – MAN’s
5 Law - from Sinai to Calvary – MAN’s
6 Grace - from Calvary to the Kingdom – MAN’s
7 Kingdom - the 1000-year Messianic Era – GOD’s.

Joshua is the SIXTH book of the Old Testament:

The book of Joshua is:
The first book named after a MAN.
The word Joshua has SIX letters.
The word MEN occurs SIX times in Joshua SIX (verses 2,3,9,13,22,23)
Israel marches around Jericho SIX times in chapter SIX.
SIX times once a day for SIX days, the seventh day – SEVEN times (millenium reign)
Joshua has 24 (4 x SIX) chapters.
The word MAN occurs 30 (5 x SIX) times in Joshua.

Romans is the SIXTH book of the New Testament:

The book of Romans is:
The word Romans has SIX letters. (Only book in NT with SIX letters.)
Romans has the word MAN in it – RoMANs (only book in the Bible with MAN)
MAN is the SIXTH word in Romans CHAPTER SIX:SIX(6:6)
MAN is the SIXTH word in SIX verses in Romans (2:1, 2:3, 2:6, 3:28, 5:7, 6:6)
Romans has SIXteen chapters

The phrase "Son of MAN" is found in 84 (14 x SIX) verses in the New Testament. FOURTEEN is the number for DELIVERANCE and SIX is the number for MAN. Jesus Christ, the Son of MAN, came into the world to DELIVER (14) MAN (6).

Even the secular world of MAN is woven with the number SIX. The world may "boast" of the antiquity and irrelevance of the King James Bible, but they continually "testify" to it’s truthfulness.

For instance, in the world system of MAN:

There are SIXty seconds (SIX x 10) in a minute.
There are SIXty minutes (SIX x 10) in an hour.
There are 24 (4 x SIX) hours in a day.
There are 360 (60 x SIX) days in the Biblical year.
There are 12 (2 x SIX) months in a year.
There are 24 (4 x SIX) Time zones.
There are 360 (SIXty x SIX) degrees in longitude and latitude
There are 12 (2 x SIX) inches in a foot.
There are 36 (SIX x SIX) inches in a yard
There are 5280 (880 x SIX) feet in a mile
There are 360 (SIXty x SIX) degrees in a circle - the earth.

You could not do it with ANY other number – try it! Pick ANY other number and try it!

There are SIX major members in the human body; head, torso, two arms and two legs.
The average body contains approximately SIX quarts of blood.
The blood in the average body, travels 12,000 miles (2,000 x SIX) in one day.
The average heart beats 72 (12 x SIX) times a minute
There are SIXty Thousand (60,000 = SIX x 10,000) miles (that's right 60,000 MILES!) of blood vessels in the human body
The average lung weighs about SIX hundred grams.
The average lung’s capacity is SIX liters.
There are SIX hundred muscles in the human body
There are SIX senses in the human body -- seeing, hearing, smelling, tasting, touching and equilibrium
There are SIX primary systems in the human body: the skeletal, circulatory, muscular, nervous, digestive and reproductive.
The standard measure for a man is SIX feet.
Average weight at birth is SIX lbs.
Population is right now – SIX billion (good time for the Lord to come)

Ever wondered why a MAN is buried SIX feet in the ground? Call your local cemetery and ask them why specifically SIX? Why not 7 or 8 or 5 etc.? WHY SIX? I personally called several cemeteries and asked them why SIX feet? None had any idea, other than that’s the "de facto standard". But, I know why. . . SIX is the number for man.

By the way, when TV produced a show on the "bionic MAN" what did they call it? You betcha’ – The SIX million dollar man.

Wonder why? SIX is God’s number for MAN.

As you can plainly see, when God establishes a "number-relationship" — it is certain.

What about the number eleven?

Is there a specific meaning connected with the number eleven found in the Word of God?

There are two clear meanings associated with the number eleven.

One meaning of the number "eleven" is urgent, the last chance, or something is about to happen.

This meaning is expressed in the "eleventh hour". The Lord Jesus Christ speaks of the number "eleven" only twice, both times in Matthew 20, in the phrase "the eleventh hour".

The "eleventh hour" is urgency, the last chance before something happens.

Matthew 20
20:1 For the kingdom of heaven is like unto a man that is an householder, which went out early in the morning to hire labourers into his vineyard.
2 And when he had agreed with the labourers for a penny a day, he sent them into his vineyard.
3 And he went out about the third hour, and saw others standing idle in the marketplace,
4 And said unto them; Go ye also into the vineyard, and whatsoever is right I will give you. And they went their way.
5 Again he went out about the sixth and ninth hour, and did likewise.
4 And said unto them; Go ye also into the vineyard, and whatsoever is right I will give you. And they went their way.
5 Again he went out about the sixth and ninth hour, and did likewise.
6 And about the eleventh hour he went out, and found others standing idle, and saith unto them, Why stand ye here all the day idle?
7 They say unto him, Because no man hath hired us. He saith unto them, Go ye also into the vineyard; and whatsoever is right, that shall ye receive.
8 So when even was come, the lord of the vineyard saith unto his steward, Call the labourers, and give them their hire, beginning from the last unto the first.
9 And when they came that were hired about the eleventh hour, they received every man a penny.
10 But when the first came, they supposed that they should have received more; and they likewise received every man a penny.
11 And when they had received it, they murmured against the goodman of the house,
12 Saying, These last have wrought but one hour, and thou hast made them equal unto us, which have borne the burden and heat of the day.
13 But he answered one of them, and said, Friend, I do thee no wrong: didst not thou agree with me for a penny?

In Biblical times, a day was measured in 12 hour increments, from sunrise to sunset, and the twelfth hour was darkness and night. So the phrase the eleventh hour referred to the very last hour, the hour just before sunset.

In Matthew 20, the Lord Jesus coined the famous phrase "the eleventh hour". The "eleventh hour" has echoed through the years as a warning or urgency: "time is running out" – "the last possible moment."

A few secular definitions of the "eleventh hour":

Idioms & Axiums currently used in America, says of the "eleventh hour":
"To come at "the eleventh hour" implies that it comes in the last hour before the deadline."
(Idioms & Axiums currently used in America, www.pride-unlimited.com/probono/idioms1.html)

Idiom Archive, writes:
"at the eleventh hour(adv) :at the latest or last possible time. The latest possible moment. Time just before it is too late"
(Idiom Archive, www.eltc.com/idioms.html)

InfoPlease, has under "the eleventh hour":
"The eleventh hour: the last possible moment for doing something: to change plans at the eleventh hour."
(www.infoplease.com)

The number eleven is clearly connected with "the last chance".

Is the Lord sending America and the world an urgent "eleventh hour" warning? Are we standing at the "eleventh hour" before the "deadline"?

Are we watching the "eleventh hour" of a major event in human history?

Maybe. . .

The Bible plainly paints another portrait of the number eleven. One that unmistakably weaves throughout the Word of God.

And one that is much clearer. . . and much, much more alarming.

The Bible clearly associates the number eleven with "judgement".

THE FIRST JUDGEMENT AFTER THE FALL. . .

The first "judgement" executed upon mankind after the fall of man, resulted from Cain killing his brother Abel. The judgement was executed in Genesis chapter four verse "eleven".

Genesis 4:11
And now art thou cursed from the earth, which hath opened her mouth to receive thy brother's blood from thy hand;

Somebody's probably thinking. . . Whoa! Just a minute. . . The chapter and verse numbers aren't "inspired" — there are no chapter and verse numbers in the "original Hebrew" manuscripts! So that eliminates any chapter/verse number "meanings".

If the chapters and numbers for the verses aren't "inspired" — are the "vowels" and "spaces"? There are no vowels, spaces or lower case letters in the "original Hebrew" text. (also the Hebrew text read left to right).

If only the "original Hebrew" manuscript is inspired, etc. — let's remove the spaces, vowels and lower case letters from the Old Testament! By doing so, can you read the following chapter?

SLMFDVDTHLRDSMYSHPHRDSHLLNTWNTHMK
THMTLDWNNGRNPSTRSHLDTHMBSDTHSTLLW
TRSHRSTRTHMYSLHLDTHMNTHPTHSFRGHTS
NSSFRHSNMSSKYTHGHWLKTHRGHTHVLLYFT
HSHDWFDTHWLLFRNVLFRTHRTWTHMTHYRDN
DTHYSTFFTHYCMFRTMTHPRPRSTTBLBFRMN
THPRSNCFMNNMSTHNNTSTMYHDWTHLMYCPR
NNTHVRSRLYGDNSSNDMRCYSHLLFLLWMLLT
HDYSFMYLFNDWLLDWLLNTHHSFTHLRDFRVR

Have we settled that?
Are we ready to proceed?
Thank you. . . ;-)

THE SECOND JUDGEMENT WAS NOAH’S FLOOD. . .

The second judgment was the flood of Noah’s day. The "judgement" was executed in Genesis chapter seven verse "eleven".

Genesis 7:11
In the six hundredth year of Noah's life, in the second month, the seventeenth day of the month, the same day were all the fountains of the great deep broken up, and the windows of heaven were opened.

THE THIRD JUDGEMENT FELL UPON CANAAN. . .

Noah had three sons; Shem, Ham and Japheth. Because that Ham looked upon the "nakedness of his father" God executed judgement against Ham’s son Canaan. Note: God couldn’t curse Ham because God had already blessed Ham in Genesis 9:1, so the curse fell to Canaan.

Genesis 9:25, describes the judgement of Canaan:

Genesis 9:25
And he said, Cursed be Canaan; a servant of servants shall he be unto his brethren.

Ever wondered why God "judged" Ham's son Canaan? Ham had at least four sons; Cush, Mizraim, Phut, and Canaan (Genesis 10:6). Why the curse on Canaan? Normally, the curse or blessing is bestowed upon the first-born. Why the "cursed be Canaan"?

Was it because Canaan had "eleven" sons? The "curse of Canaan" was executed upon the "eleven" sons of Canaan.

Genesis 10:15-18
15 And Canaan begat Sidon (1) his firstborn, and Heth, (2)
16 And the Jebusite, (3) and the Amorite, (4) and the Girgasite, (5)
17 And the Hivite, (6) and the Arkite, (7) and the Sinite, (8)
18 And the Arvadite, (9) and the Zemarite, (10) and the Hamathite: (11) and afterward were the families of the Canaanites spread abroad.

THE JUDGEMENT AT THE TOWER OF BABEL. . .

The Bible describes the infamous "Tower of Babel". The Tower of Babel was Nimrod’s attempt to bring in history’s heralded "one-world-order". And God executed judgement on Nimrod and company by confounding their language, so they couldn’t understand each other:

The judgement on Nimrod occurred in Genesis chapter "eleven" verse seven.

Genesis 11:7
Go to, let us go down, and there confound their language, that they may not understand one another's speech.

THE JUDGEMENT OF THE MEN OF SODOM. . .

Because of the wickedness of Sodom and Gomorrah, God sent two angels to destroy Sodom and Gomorrah. As the two angels came to Lot’s house, the men of Sodom surrounded Lot’s house, calling for Lot to let them have the men (the angels) for sexual perversion. And the two angels executed "judgement" on the men of Sodom by smiting them with blindness. The judgement was executed in Genesis chapter 19 verse "eleven":

Genesis 19:11
And they smote the men that were at the door of the house with blindness, both small and great: so that they wearied themselves to find the door.

THE JUDGEMENT OF EGYPT. . .

In B.C. 1700, the children of Israel were slaves to Egypt. And God called a man named Moses to deliver Israel to the "promised land". But Pharaoh, king of Egypt refused to let Israel go. Because Pharaoh, king of Egypt refused to release the children of Israel, the Lord executed "eleven" judgements against Egypt:

1. The plague of Blood. (Exodus 7:19-21)
2. The plague of Frogs. (Exodus 8:1-7)
3. The plague of Lice. (Exodus 8:16-17)
4. The plague of Flies. (Exodus 8:21-24)
5. The plague of Murrain. (Exodus 9:1-7)
6. The plague of Boils. (Exodus 9:8-11)
7. The plague of Hail. (Exodus 9:22-25)
8. The plague of Locusts. (Exodus 10:12-15)
9. The plague of Darkness(Exodus 10:21-23)
10. The death of the First-Born. (Exodus 12:29-30)
11. The drowning at the red Sea. (Exodus 14:24-28)

THE JUDGEMENT OF ISRAEL. . .

After the Lord God delivered Israel from the bondage of Egypt, Israel was to return to the land promised to Abraham in Genesis 17:8. As the children of Israel came close to the promised land, in Numbers 13, they stopped at Kadeshbarnea. There, they sent out twelve men, one from each tribe, to search out the promised land. Even though, the Lord God had already promised the land to Israel, when the spies returned — "eleven" elected not to go in and possess the "promised land". In Numbers 13:30, it was only, Caleb that said, ". . .Let us go up at once, and possess it;. . ." The other "eleven", the Bible says in Numbers 13:32, brought back an "evil report".

Numbers 13:32
And they [the eleven] brought up an evil report of the land which they had searched unto the children of Israel, saying, The land, through which we have gone to search it, is a land that eateth up the inhabitants thereof; and all the people that we saw in it are men of a great stature.

Because of the evil report of "eleven", Israel refused to go into the promised land. And "judgement" was executed on Israel as they wandered in the wilderness for forty years.

Because of "eleven" – judgement was executed upon Israel.

But there’s more. . .

In Deuteronomy 1:2, the Bible specifically tells us when Israel stopped in Kadeshbarnea, in Numbers 13, where the Lord executed the judgement upon Israel – it was an "eleven" days journey from Horeb!

Deuteronomy 1:1-2
1 These be the words which Moses spake unto all Israel on this side Jordan in the wilderness, in the plain over against the Red sea, between Paran, and Tophel, and Laban, and Hazeroth, and Dizahab.
2 (There are eleven days' journey from Horeb by the way of mount Seir unto Kadeshbarnea.)

If Israel would have only kept going! If Israel would have traveled twelve days – only one more day, they would have been in the God ordained, promised land. But because they stopped at "eleven" – judgement was executed upon Israel.
# Because of an "eleven" days journey. . .
# Because of "eleven" men’s evil report. . .
# Judgement was executed upon Israel – for forty, long, wandering, suffering years!

Is there any doubt "eleven" is God’s number for judgement?

But there’s much more evidence. . .

THE JUDGEMENT OF SAMSON. . .

Judgement was executed upon Samson because of "eleven" hundred pieces of silver. The Philistines paid Delilah "eleven" hundred pieces of silver to sell Samson out.

Judges 16:5
And the lords of the Philistines came up unto her [Delilah], and said unto her, Entice him, and see wherein his great strength lieth, and by what means we may prevail against him, that we may bind him to afflict him: and we will give thee every one of us eleven hundred pieces of silver.

THE JUDGEMENT OF SOLOMON. . .

One of the keys for unlocking any specific meaning to certain numbers in the Bible is match the book number, chapter and verse with the selected number. Dr. Peter Ruckman explains this technique in his book, Bible Numerics:

"As a general practice in trying to find a number, the thing you do is find the number of that book – like if you are looking for eleven, you take the eleventh book in the Bible. Then when you have found the eleventh book, take the eleventh chapter and look at the eleventh verse."
(Dr. Peter S. Ruckman, Bible Numerics, p. 33)

Shall we try it?

The eleventh book is I Kings. I Kings 11:11 reads:

Wherefore the LORD said unto Solomon, Forasmuch as this is done of thee, and thou hast not kept my covenant and my statutes, which I have commanded thee, I will surely rend the kingdom from thee, and will give it to thy servant.
(1 Kings 11:11)

I kings 11:11 is a obvious reference to judgement upon Solomon.

Solomon was the greatest, mightiest and wealthiest kingdom on earth during his day – ditto U.S.A. And because Solomon disobeyed God’s word, and "kept not my covenant and my statutes", God removed His blessing and protection from him – ditto U.S.A?

THE JUDGEMENT OF ISRAEL. . .

Only TWO Kings, Jehoiakim and Zedekiah, reigned "eleven" years in Israel and both brought terrible judgement upon Israel.

THE JUDGEMENT OF JEHOIAKIM. . .

2 Kings 23 and 2 Chronicles 36, reads judgement was executed during Jehoiakim’s "eleven" year kingdom.

2 Kings 23:36 – 24:4
36 Jehoiakim was twenty and five years old when he began to reign; and he reigned eleven years in Jerusalem. And his mother's name was Zebudah, the daughter of Pedaiah of Rumah.
37 And he did that which was evil in the sight of the LORD, according to all that his fathers had done.
24:1 In his days Nebuchadnezzar king of Babylon came up, and Jehoiakim became his servant three years: then he turned and rebelled against him.
2 And the LORD sent against him bands of the Chaldees, and bands of the Syrians, and bands of the Moabites, and bands of the children of Ammon, and sent them against Judah to destroy it, according to the word of the LORD, which he spake by his servants the prophets.

2 Chronicles 36:5-8
5 Jehoiakim was twenty and five years old when he began to reign, and he reigned eleven years in Jerusalem: and he did that which was evil in the sight of the LORD his God.
6 Against him came up Nebuchadnezzar king of Babylon, and bound him in fetters, to carry him to Babylon.
7 Nebuchadnezzar also carried of the vessels of the house of the LORD to Babylon, and put them in his temple at Babylon.
8 Now the rest of the acts of Jehoiakim, and his abominations which he did, and that which was found in him, behold, they are written in the book of the kings of Israel and Judah: and Jehoiachin his son reigned in his stead.

THE JUDGEMENT OF ZEDEKIAH. . .

2 Kings 24 and 2 Chronicles 36, tells of the judgement that was also executed during Zedekiah’s "eleven" year kingdom. Notice also, in 25:2, Jerusalem was besieged "eleven" years before judgement fell.

2 Kings 24
18 Zedekiah was twenty and one years old when he began to reign, and he reigned eleven years in Jerusalem. And his mother's name was Hamutal, the daughter of Jeremiah of Libnah.
19 And he did that which was evil in the sight of the LORD, according to all that Jehoiakim had done.
20 For through the anger of the LORD it came to pass in Jerusalem and Judah, until he had cast them out from his presence, that Zedekiah rebelled against the king of Babylon.
25:1 And it came to pass in the ninth year of his reign, in the tenth month, in the tenth day of the month, that Nebuchadnezzar king of Babylon came, he, and all his host, against Jerusalem, and pitched against it: and they built forts against it round about.
2 And the city was besieged unto the eleventh year of king Zedekiah.
3 And on the ninth day of the fourth month the famine prevailed in the city, and there was no bread for the people of the land.

2 Chron 36
11 Zedekiah was one and twenty years old when he began to reign, and reigned eleven years in Jerusalem.
12 And he did that which was evil in the sight of the LORD his God, and humbled not himself before Jeremiah the prophet speaking from the mouth of the LORD.
13 And he also rebelled against king Nebuchadnezzar, who ad made him swear by God: but he stiffened his neck, and hardened his heart from turning unto the LORD God of Israel.
14 Moreover all the chief of the priests, and the people, transgressed very much after all the abominations of the heathen; and polluted the house of the LORD which he had hallowed in Jerusalem.
15 And the LORD God of their fathers sent to them by his messengers, rising up betimes, and sending; because he had compassion on his people, and on his dwelling place:
16 But they mocked the messengers of God, and despised his words, and misused his prophets, until the wrath of the LORD arose against his people, till there was no remedy.

It’s worth noting also, that Zedekiah was the "last chance" or "eleventh hour". Zedekiah was the last king. After Zedekiah, Nebuchadnezzar in 606 B.C. came and destroyed Israel. And the nation of Israel ceased to exist until 1948!

Zedekiah reigned "eleven" years, at the "eleventh hour" — the "last chance" before judgement that was from the ". . .wrath of the LORD. . . till there was no remedy."

Is there any doubt "eleven" is God’s number for judgement?

Somebody is probably thinking, that’s all "just coincident". . .

Nothing is "just coincident" in the Word of God. . .

Every single word, every single number is EXACLTY what the Lord ordained.

Every single word, every single number is there for a purpose – nothing in the words of God is just coincident!

Luke 4:4
And Jesus answered him, saying, It is written, That man shall not live by bread alone, but by every word of God.

According to the Lord Jesus Christ, inspiration of the words of God, apply even to the smallest, "one jot or one tittle".

Matthew 5:18
For verily I say unto you, Till heaven and earth pass, one jot or one tittle shall in no wise pass from the law, till all be fulfilled.

A "jot" is the smallest letter in the Greek or Hebrew. The "tittle" is accents and diacritical points. A "tittle" would be similar to the "dot" on our "i". In other words, a jot or tittle is the smallest stroke of the pen. And if, inspiration, preservation and fulfillment includes each "jot" or "tittle", then numbers in the Word of God, would certainly be inspired.

Even the world system, unknowingly, connects the number "eleven" with judgement.

In Brewer's Dictionary of Twentieth-Century Phrase and Fable, under the definition for "eleven plus", Brewer's writes:

"eleven plus The name given to the much-abused selection test formerly set to school-children at the age of eleven, or just over that age, and used in England and Wales as a means of judging their suitability for the various types of secondary education. . ."
(Brewer's Dictionary of Twentieth-Century Phrase and Fable, p. 175)

Somebody’s probably thinking. . . You could do the same thing with any number.

Try it. . .

Show me any other number in the Bible, so clearly connected with judgement, especially major judgements. It's not there. Try it. I’ll be waiting. . .Email me

THE JUDGEMENT OF TYRUS. . .

Ezek 26:1-4
26:1 And it came to pass in the eleventh year, in the first day of the month, that the word of the LORD came unto me, saying,
2 Son of man, because that Tyrus hath said against Jerusalem, Aha, she is broken that was the gates of the people: she is turned unto me: I shall be replenished, now she is laid waste:
3 Therefore thus saith the Lord GOD; Behold, I am against thee, O Tyrus, and will cause many nations to come up against thee, as the sea causeth his waves to come up.
4 And they shall destroy the walls of Tyrus, and break down her towers: I will also scrape her dust from her, and make her like the top of a rock.

THE JUDGEMENT OF PHAROAH KING OF EGYPT. . .

Ezek 30:20-23
20 And it came to pass in the eleventh year, in the first month, in the seventh day of the month, that the word of the LORD came unto me, saying,
21 Son of man, I have broken the arm of Pharaoh king of Egypt; and, lo, it shall not be bound up to be healed, to put a roller to bind it, to make it strong to hold the sword.
22 Therefore thus saith the Lord GOD; Behold, I am against Pharaoh king of Egypt, and will break his arms, the strong, and that which was broken; and I will cause the sword to fall out of his hand.
23 And I will scatter the Egyptians among the nations, and will disperse them through the countries.

THE ELEVEN APOSTLES. . .

Judgement at Calvary was executed on the Lord Jesus Christ while there were "eleven" apostles.

The judgement of our sins was placed on the sinless, Lord Jesus Christ on the cross of Calvary. He died as a curse. God’s judgement for sins was satisfied. (Isaiah 53:11)

Galatians 3:13
Christ hath redeemed us from the curse of the law, being made a curse for us: for it is written, Cursed is every one that hangeth on a tree:

Even though, the Lord Jesus taught and preached openly for over three years, it was only after the defection of Judas, and the "eleven" apostles that "judgement" was executed.

The Bible says, the night Judas defected, Jesus Christ was taken to the hall of "judgement":

John 18:
28 Then led they Jesus from Caiaphas unto the hall of judgment: and it was early; and they themselves went not into the judgment hall, lest they should be defiled; but that they might eat the passover.
29 Pilate then went out unto them, and said, What accusation bring ye against this man?
30 They answered and said unto him, If he were not a malefactor, we would not have delivered him up unto thee.
31 Then said Pilate unto them, Take ye him, and judge him according to your law. The Jews therefore said unto him, It is not lawful for us to put any man to death:

Ever wondered why, in Acts chapter one, just before the Holy Spirit comes in Acts 2, that the apostles chose a replacement apostle for Judas? One reason is they needed twelve Apostles because they were promised to set upon twelve thrones, one for each tribe of Israel (Matt. 19:28) But could it also be . . . that the judgement had passed. And the "eleven" Apostles must now be "twelve" Apostles?

THE BIBLE - GOD'S JUDGEMENT ON MAN. . .

The number of books in the Bible is 66 or 6 x 11. "Six" is the number for man. "Eleven" is the number for judgement.

The Bible is God’s judgement on man.

That’s one reason it’s the most hated book on the earth. That’s why the Bible has been burnt, condemned, mocked, forbidden, attacked throughout history. That’s why people fight against having the simple Ten Commandments displayed. It "judges" them.

Hebrews 4:12 says, the Bible is a "discerner of the thoughts and intents of the heart". A discerner is a judge.

Hebews 4:12
For the word of God is quick, and powerful, and sharper than any twoedged sword, piercing even to the dividing asunder of soul and spirit, and of the joints and marrow, and is a discerner of the thoughts and intents of the heart.

All through the Bible, the words of God are referred to as "judgements".

Exodus 24:3
And Moses came and told the people all the words of the LORD, and all the judgments: and all the people answered with one voice, and said, All the words which the LORD hath said will we do.

In John 12:47-48, Jesus Christ, said the Bible shall "judge" us in the last day

John 12:47-48
47 And if any man hear my words, and believe not, I judge him not: for I came not to judge the world, but to save the world.
48 He that rejecteth me, and receiveth not my words, hath one that judgeth him: the word that I have spoken, the same shall judge him in the last day.

God’s "66" (6 x 11) books are "judgements" (11) against (x) mankind (6). In fact, you can not even be saved, until you are "judged" by the Word of God and found guilty!.

Romans 5:6-8
6 For when we were yet without strength, in due time Christ died for the ungodly.
7 For scarcely for a righteous man will one die: yet peradventure for a good man some would even dare to die.
8 But God commendeth his love toward us, in that, while we were yet sinners, Christ died for us.

Another interesting reference to the Word of God, "eleven" and judgement, occurs in Psalm 119.

The subject of Psalm 119, (which is the longest chapter in the Bible), is the word of God. It’s interesting, that the word "judgement" occurs 22 times in Psalm 119. 22 is 2 x 11. In the Bible, one of the meanings of the number "two" is a "witness". I also found it curious, that Psalm 119 = 1 + 1 + 9 = 11.

Matthew 18:16 says:
". . . that in the mouth of two or three witnesses every word may be established."

# Two thieves witnessed the crucifixion of the Lord Jesus Christ (Mark 15:27)
# Two angels witnessed the resurrection of the Lord Jesus Christ (Luke 24:4)
# Two angels witnessed the ascension of the Lord Jesus Christ. (Acts 1:10-11)

It’s interesting the book of Revelation has 22 chapters, 2 (witness) x 11 (judgement). The book of Revelation is the "testimony" (Rev. 1:2 – a testimony is a witness) of the Lord Jesus Christ, the faithful "witness" (Rev. 1:5) of the "judgement" of God. (Rev 6:17, 11:18, 14:10, 14;19, 15:1, 16:1, et al).

Guess what shows up in Revelation chapter 11? The "two" witnesses (hence 2 x 11 = 22)!

Revelation 11:3
And I will give power unto my two witnesses, and they shall prophesy a thousand two hundred and threescore days, clothed in sackcloth.

When Jesus Christ sent the Apostles out to be a witness, He sent them out "two and two":

Matthew 6:7
And he called unto him the twelve, and began to send them forth by two and two; and gave them power over unclean spirits;

Even today, every "witnessing" program or course, I’ve ever seen sends out the "witnesses" into groups of "two" (ditto Jehovah Witnesses, Mormons, etc.). Also, every major event in the Bible, the Lord has at least two witnesses. Why do you think Moses took Joshua with him into Mount of God to receive the ten commandments (Exodus 24:13)?

The word of God is a "witness" (2) to the righteous "judgement" (11) of God.

The 22 (2 x 11) "judgements" in Psalm 119:

1. With my lips have I declared all the judgments of thy mouth. (Psalms 119:13)
2. My soul breaketh for the longing that it hath unto thy judgments at all times. (Psalms 119:20)
3. I have chosen the way of truth: thy judgments have I laid before me. (Psalms 119:30)
4. Turn away my reproach which I fear: for thy judgments are good. (Psalms 119:39)
5. And take not the word of truth utterly out of my mouth; for I have hoped in thy judgments. (Psalms 119:43)
6. I remembered thy judgments of old, O LORD; and have comforted myself. (Psalms 119:52)
7. At midnight I will rise to give thanks unto thee because of thy righteous judgments. (Psalms 119:62)
8. Teach me good judgment and knowledge: for I have believed thy commandments. (Psalms 119:66)
9. I know, O LORD, that thy judgments are right, and that thou in faithfulness hast afflicted me. (Psalms 119:75)
10. How many are the days of thy servant? When wilt thou execute judgment on them that persecute me? (Psalms 119:84)
11. I have not departed from thy judgments: for thou hast taught me. (Psalms 119:102)
12. I have sworn, and I will perform it, that I will keep thy righteous judgments. (Psalms 119:106)
13. Accept, I beseech thee, the freewill offerings of my mouth, O LORD, and teach me thy
14. judgments. (Psalms 119:108)
15. My flesh trembleth for fear of thee; and I am afraid of thy judgments. (Psalms 119:120)
16. I have done judgment and justice: leave me not to mine oppressors. (Psalms 119:121)
17. Righteous art thou, O LORD, and upright are thy judgments. (Psalms 119:137)
18. Hear my voice according unto thy lovingkindness: O LORD, quicken me according to thy judgment. (Psalms 119:149)
19. Great are thy tender mercies, O LORD: quicken me according to thy judgments. (Psalms 119:156)
20. Thy word is true from the beginning: and every one of thy righteous judgments endureth for ever. (Psalms 119:160)
21. Seven times a day do I praise thee because of thy righteous judgments. (Psalms 119:164)
22. Let my soul live, and it shall praise thee; and let thy judgments help me. (Psalms 119:175)

If you also notice in your Bible, Pslam 119, has 22 divisions (2 x 11) for the 22 letters of the Hebrew alphabet. This is the only chapter in the Bible with such divisions. Interesting. . .

THE JUDGEMENT OF JESUS CHRIST. . .

Jesus Christ was 33 (3 x 11) years old when He died on Calvary. The number "three", in the Bible, clearly refers to deity, or God. Jesus Christ was God in the flesh (1 Timothy 3:16). When Jesus Christ died on Calvary, God (3) took our judgement (11).

Gen 22:8
And Abraham said, My son, God will provide himself a lamb for a burnt offering: so they went both of them together.

Acts 20:28 Take heed therefore unto yourselves, and to all the flock, over the which the Holy Ghost hath made you overseers, to feed the church of God, which he hath purchased with his own blood.

THE GREAT WHITE THRONE JUDGEMENT. . .

Interesting, when John was watching the Great White Throne judgement in Revelation 20, John saw "eleven" things, which just so happens to begin in verse "eleven".

Revelation 20:11-15
11 And I saw (1) a great white throne, and (2) him that sat on it, from whose face the earth and the heaven fled away; and there was found no place for them.
12 And I saw (3) the dead, small and great, stand before God; and (4) the books were opened: and (5) another book was opened, which is the book of life: and (6) the dead were judged out of those things which were written in the books, according to their works.
13 And (7) the sea gave up the dead which were in it; and (8) death and hell delivered up the dead which were in them: and (9) they were judged every man according to their works.
14 And (10) death and hell were cast into the lake of fire. This is the second death.
15 And (11) whosoever was not found written in the book of life was cast into the lake of fire.

There is no doubt. . . The number "eleven" is connected to judgement and urgency in the Word of God.

AND THE NUMBER SEVEN. . .

There is also found in the Bible and in the world an interconnection between the numbers "eleven" and "seven".

E.W. Bullinger, dedicates several pages in his book, Number in Scripture, to the "seven" and "eleven" combination. Bullinger writes:

"It is sufficient for our purpose now, merely to note that these two numbers, seven and 11, have been specially selected. . . that there is such a remarkable relation between them must be due to design. . .Why should it be these two numbers seven and 11? Why not any other two numbers? Or why two at all? Why not three? We may or may not be able to explain why, but we cannot close our eyes to the fact."
(E.W. Bullinger, Number in Scripture, p.25)

Bullinger lists several incredible relations between the number 7 and 11, such as:
# In Music: seven primary notes and eleven semi-notes.
# In Geometry: As 7 is to 11, so is the height of a pyramid (whose base is a square) to the length of its base.
As 7 is to 11 expresses also the ratio between the diameter of a circle and its semi-circumference; or between a semicircle and its chord.
# (Note: Bullinger (pp. 20-47) has much more detailed info on this 7 and 11 phenomenon in relation to science, math, etc)

The "7 and 11" combo has some interesting occurrences in the world system. For instance: The famous dice roll of "seven come eleven", or the famous chain of convenience stores of "Seven Eleven".

It’s also interesting that "seven" and "eleven" are the only two primary numbers that rhyme. It’s also worth noting that 7 = 3 + 4, and 11 = 5 + 6, and that 3,4,5,6 are a perfect arithmetic progression, and the product of 3 x 4 x 5 x 6 = 360. Our world is divided into 360 parts; for instance, there are 360 days in the Biblical year, 360 degrees in a circle, 360 degrees of longitude and latitude, and the "circle of heaven" used in the Zodiac is divided into 360 parts.

What about the number "seven" in scripture?

The meaning of the number seven is one of the clearest in scripture. It is the number for completion. This is found throughout scripture.

Peter Ruckman, writes in his book, Bible Numerics:

"Now we come to the number Seven. There is no need for a great deal of thought or research or study or consideration as Seven is so obviously the number of completion that it doesn’t need any justification." (Peter S. Ruckman, Bible Numerics, p.23)

A few examples of the number seven and completion in the scriptures:

The Creation: (this is the first time the number seven occurs)

Genesis 2:2
And on the seventh day God ended his work which he had made; and he rested on the seventh day from all his work which he had made.

The last book in the Bible, the book of Revelation is filled with the number seven (59 times in Revelation):

For example, in the last book, Revelation, there are:

# Seven Churches (Rev 1:4)
# Seven Spirits (Rev 1:4)
# Seven Candlesticks (Rev 1:12)
# Seven Stars (Rev 1:16)
# Seven Lamps of Fire (Rev. 4:5)
# Seven Spirits of God (Rev 4:5)
# Seven Seals (Rev. 5:1)
# Seven Horns (Rev 5:6)
# Seven Eyes (Rev 5:6)
# Seven Angels (Rev 8:2)
# Seven Trumpets (Rev 8:2)
# Seven Thunders (Rev 10:3)
# Seven Thousand (Rev 11:13)
# Seven Heads (Rev 12:3)
# Seven Crowns (Rev 12:3)
# Seven Plagues (Rev 15:1)
# Seven Golden Vials (Rev. 15:7)
# Seven Mountains (Rev. 17:9)
# Seven Kings (Rev. 17:10)

Why so many "sevens" in the book of Revelation. Because Revelation completes the plan of God – it’s completed — at seven.

A couple of other examples of seven and completion (and many, many more could be givien)

Revelation 10:7
But in the days of the voice of the seventh angel, when he shall begin to sound, the mystery of God should be finished, as he hath declared to his servants the prophets.

Rev 16:17 And the seventh angel poured out his vial into the air; and there came a great voice out of the temple of heaven, from the throne, saying, It is done.

If "seven" is the number for completion, and if "eleven" is the number for judgement – is there a connection in the Word of God?

Did you notice that the "judgment" of the flood of Noah occurred in Genesis 7:11 and the "judgement" of the Tower of Babel occurred in Genesis 11:7? (Yes. There is a reason. . . You should be able to figure that one out.)

There is also some peculiar occurrences of the number "seven" in the World trade Center bombing – and significantly — it’s relationship to the number "eleven".

# The Date of the Attack 9/11: 9 + 1 + 1 = 11, but 9 - 1 - 1 = 7
# September 11th is the 254th day of the year: 5 + 4 + 2 = 11, but 5 + 4 - 2 = 7
# New York City = 11 letters, but New York = 7 letters
# Flight 11 had 92 passengers, 9 + 2 = 11, but 9 - 2 = 7

# The second flight was Flight 77 = 7 x 11

# And the month of September is actually the Latin name for seven!

Does this mean, with the large number of occurrences of the number of "eleven", that God allowed the Trade Center bombing as a judgement on the US? Could this be a warning that America is heading for judgement?

Does the combination of "seven" and "eleven" mean that America is finished, complete, and headed for judgement?

Have you wondered, how did the greatest and most widespread surveillance technology in history fail to get a hint of the Trade Center bombing? With such elaborate spy technology as the NSA’s Echelon, which captures every form of electronic communication, such as telephones, computers, emails, etc. — how did we miss it? With spy satellite systems that can spot a tennis ball, with their "eye" on Bin Laden — how did they not see something happening? How did countries like Israel, with world renown terrorism surveillance technology miss it? The Trade Center bombing was planned for over a year, involving hundreds of people, several countries, millions of dollars, passport fraud, airplane licenses, and scores of other "red flag" warnings — and yet over and over — everyone missed it! How? Congress has rightly, called for investigations into how in the world, with all our high-tech surveillance technology miss something this huge and elaborate. It’s almost as if somehow, 10,000 to 20,000 surveillance and spy personnel, were "blind" while all this went on. As Christians across America has asked, "Did God remove His protection from America?"

Is America heading for judgement?

Maybe. . .

Maybe not. . .

To be honest, no one, but God knows.

This could be the "beginning of the end" of America the great, or the greatest days in America’s history could be just around the corner.

No one knows for certain . . .

But one thing we do know for certain — we will all stand before the judgement of God. . .

Make no mistake about it — one day, you will stand before God.

One day you will die and you will stand before the judgement of God.

Hebrews 9:27 is very clear:

And as it is appointed unto men once to die, but after this THE JUDGEMENT.

And friend, there is only ONE that can get you through that judgement. . . ONLY ONE!

The Lord Jesus Christ!
Jesus saith unto him, I am the way, the truth, and the life: no man cometh unto the Father, but by me.
John 14:6

Death is certain. . . One day you will die. . .

I remember seeing on TV, the wife of a man that died during the World Trade Center bombing. She was crying and saying, "It started off just like any other day. He got ready for work. Kissed me going out the door. And a few hours later — he’s dead! He had no warning!"

You could have been in the World Trade Centers. . .

This very minute — you could very easily be in heaven — or in hell.

It could be tomorrow, maybe next week, next year, 5 years, 10 years, 20 years, 50 years . . .

Boast not thyself of to morrow; for thou knowest not what a day may bring forth.
Proverbs 27:1

One thing is certain — death is coming.

Friend, I want to ask you the most important question you’ll ever answer. . .

Have you ever received the Lord Jesus Christ as your Saviour? Have you trusted the payment Jesus Christ made on the cross of Calvary for your sin?

To be honest, the real reason for this article is not the World Trade Center bombing, that’s mainly to get your attention to illustrate just how fragile and uncertain life is. The real reason for this article — I do not want you to spend eternity in a lake of fire.

And whosoever was not found written in the book of life was cast into the lake of fire.
Revelation 20:15

When I first heard the tragic news of the World Trade Center bombing my very first thought was how many of those unsuspecting people were prepared to meet God?

Are you prepared to meet God?

One thing the World Trade Center certainly showed us death can happen in an unsuspecting second — with no "last chance" of getting prepare to meet God.

And as it is appointed unto men once to die, but after this THE JUDGEMENT. Hebrews 9:27

Friend, If you've never trusted the Lord Jesus Christ, you can be saved this minute on this computer.

YOU CAN BE SAVED THIS VERY MINUTE!

It's simple to be saved. . .

# Know you're a sinner.

"As it is written, There is none righteous, no, not one:" Romans 3:10

"... for there is no difference. For all have sinned, and come short of the glory of God;" Romans 3:23

# That Jesus Christ died on the cross to pay for your sins.


"Who his own self bare our sins in his own body on the tree, ..." 1 Peter 2:24

"... Unto him that loved us, and washed us from our sins in his own blood," Revelation 1:5

# And the best way you know how, simply trust Him, and Him alone as your personal Savior.


"For God so loved the world, that he gave his only begotten Son, that whosoever believeth in him should not perish, but have everlasting life." John 3:16

WOULD YOU LIKE TO BE SAVED?

Pray this prayer, and mean it with all your heart.

Lord Jesus, I know that I am a sinner, and unless you save me I am lost forever. I thank you for dying for me at Calvary. I come to you now, Lord the best way I know how, and ask you to save me. I now receive you as my Savior. In Jesus Christ Name, Amen.

And as it is appointed unto men once to die, but after this the judgment:
Hebrews 9:27

What man is he that liveth, and shall not see death?
Psalm 89:48

He that believeth on the Son hath everlasting life: and he that believeth not the Son shall not see life; but the wrath of God abideth on him.
John 3:36

For what is a man profited, if he shall gain the whole world, and lose his own soul?
Mark 16:26

I want to add a comment since l too have been touched by the numbers.


Isn't it true that the 'Kabbalah Way of Knowledge' began here as mentioned above?
In fact...it was added to the roll call after their stay?

The long list that never included this alphabet now had a new member. Didn't they in fact bring it home with them and it has perverted Judaism ever sense? None of this existed for the Jewish people until after their stay?

So we've discerned the hand of God in the numbers but the devils at the calculator too..tap, tap tapping away... Yes... The rod thrown to the ground can, has and will swallow up the lesser serpents... But just because God throws his rod doesn't mean it's OK for us to throw ours...

God is doing it as a demonstration in the heavenlies and for those on earth with eyes to see. But not everyone that sees will gain approval from God. The sad truth for them is... that they will be privy to seeing their own demise coming.

I thought the Kabbalah came out of Babylon?

The Kabbalah is definitely a perversion of biblical codes and numbers because it leads one to believe in New Age Gnostic ideas.

But this, of course, does not mean that God cannot speak in codes and numbers. He has and does. But it is true that we have to be careful in this area. An eye single for the glory of Yeshua (Jesus) is what will most effectively keep someone.

If God was against all codes then God would not have written an encoded message on the palace wall in Babyon when only Daniel could interpret it. And there would not be atbash codes in Jeremiah as recognized by most bible scholars of all persuasions.

And what are most spiritual dreams in the bible but codes? A code is a secret message and most dreams sent from God as recorded in the bible was a secret message often only disciphered by one gifted, such as Joseph to Pharoh or Daniel to Nebuchadnezzar. Even the parables of Jesus were codes in this sense, "and without a parable Jesus did not speak to the people so that it might be fulfilled, 'having ears they hear not', etc... but blessed by your ears for they hear..."

So God is God of codes too, but the direction that they lead one in will tell us what origin they are, whether they be from God or Satan.

So we need to be cautious, as Miki says, but I don't think we need to be afraid to study them as long as we are looking for Jesus in them. For the bible says that they are about Him and from Him (Rev. 1:1). Indeed, is not the book of Revelation one long secret message --- a code in the general sense of the word?

"Blessed are the pure in heart for they shall see God"

So what constitutes a pure heart?

This is a portion of the first thing l googled;


http://www.horizonsnet.org/sermons/sm7.html

And this.............

[quote name='Miki' post='125829' date='Oct 24 2007, 09:42 AM']



And when we are tuned into Him, we will enjoy the privilege of catching a glimpse of His glory - a vision of His majesty. This is the promise to all who are pure in heart. If we are, we will see God.[/quote]
[/quote]
So true. Great post Miki! It is wonderful to be saved and tuned into Him isn't it? Yes. I enjoy the privilege of seeing glimpses of His Glory daily and especially His majesty like the angels in his presence.
Being born again is being pure in heart and that is what He has made me ... and you too! We shall soon see Him at the Rapture. Maranatha Miki... keep looking up.
God bless





*********************************




So we need to be cautious, as Miki says, but I don't think we need to be afraid to study them as long as we are looking for Jesus in them. For the bible says that they are about Him and from Him (Rev. 1:1). Indeed, is not the book of Revelation one long secret message --- a code in the general sense of the word?
[/quote]

Great post Shekel. No fear or superstition is needed. As born again believers with discernment one should know how to purge the dross and sift the wheat.

For God hath not given us the spirit of fear; but of power, and of love, and of a sound mind. 2 Timothy 1:7

There is no fear in love; but perfect love casteth out fear: because fear hath torment. He that feareth is not made perfect in love. 1 John 4:18

Luke 12:4-7
4And I say unto you my friends, Be not afraid of them that kill the body, and after that have no more that they can do.5But I will forewarn you whom ye shall fear: Fear him, which after he hath killed hath power to cast into hell; yea, I say unto you, Fear him.6Are not five sparrows sold for two farthings, and not one of them is forgotten before God?7But even the very hairs of your head are all numbered. Fear not therefore: ye are of more value than many sparrows.

voice...yes.

Shekel says;


This is my understanding of it. If you know different, tell me. I surmised this.

The Kabbalah never was until after captivity. It's like a virus picked up in Babylon that couldn't be gotten rid of...Like herpes. It stays in the system waiting to manifest itself under the right (ripe) conditions.

It's a form of divination. The apple was offered.

Doesn't mean God didn't fore know all that would transpire. These things belong to him but because the box was opened his mercy has incorporated the revealing into his plan. Not that we could never know the numbers of God's plan for they are in every page of the Bible...but...it's greatly mixed and that's why God looks at hearts...Be scared because with apple in hand you are easily led astray in this...Because...many truths are offered as the bait that puts you to sleep...and that's enough of my rambling.

For God hath not given us the spirit of fear; but of power, and of love, and of a sound mind. 2 Timothy 1:7

Jesus is risen from the dead. Just imagine then. Desiring to speak to his disciples, he invites them to go up on a mountain in Galilee and he gives them instructions for the future. He is again surrounded by the ELEVEN. They prostrate themselves before him as Joseph's brothers did with him, because they have become fully aware that he who is now in their midst is the Lord Jehovah God of heaven and earth. The Father has given to His only begotten Divine Son "all power"- including that of coming to judge the world at the end of time. Jesus in turn entrusts to his disciples the task of proclaiming, in his name, the good news of salvation to all nations, first in Jerusalem to his Chosen People, and then to his 'other flock' the gentiles.. This they are to accomplish through baptism and by "teaching them to observe" all that he has commanded them. Baptism alone of course is not enough: it must first be preceeded by salvation through the shed Blood of His Divine atonement; However, the great undertaking of bringing light to all nations will not be a human accomplishment, for Jesus says:

"I am with you always, until the end of the world"

Before he returns as judge, Jesus will continue to be close to his disciples in order to support them. He will be present among them, not only when they gather around the table to celebrate his death and resurrection and to take the matza with the yayin gafen , but always and in every place. Thus, a new era has begun for humanity, an era characterized by the presence of the risen Jesus. This presence is the reality which unifies the believing world, which continually gathers together "all nations" in every age and in every place, and introduces them into the Father's Kingdom of love through the Divine Messiah Jesus. This presence constitutes the Church in its most profound essence, manifested in the love and forgiveness of the 'brethren'.

"I am with you always, until the end of the world" ... always, until the end ....(Mt. 28:20)

Jesus is called "Emmanuel," which means "God-with-us." Because of his resurrection, he is near to all of us, truly with us. And, since Jesus is now always living among us, the words he said 2,000 years ago are not merely a splendid reminder of a person who existed in the past, but rather, they are words which he addresses right now to me, to you, to each one of us personally. Jehovah Jesus, Divine Creator is here now as you read this .... fearing nothing.

It is to us that he brings comfort and salvation. Some in their homes have no 'Shalom' and cry out for it, putting on an external show - even pretending to be 'godly inquisitors' but they are unsaved bluffers.
It is we who are not spiritual adulterers or adultresses (roaming the net looking for secret spiritual cyber-fornicators) that Jesus continues to serve, especially if we are poor, alone, or in difficulty. It is we whom he helps when we fall and whom he encourages in our trials of poverty and disability. He tells us not to fear without subtle condemnation, hints of hellfire or hypocrisy borne of boredom on free days of indolence.

"I am with you always, until the end of the world."

Jesus dwells in his Church. Where, then, can we encounter him? Where can we find him? He is right around the corner; he is right beside me and right beside you. He hides himself in the poor, the despised, the little ones, the sick, in those who seek advice, in those deprived of freedom. He is in the ugly, in the outcast. He said: "I was hungry and you gave me food" (Mt. 25:35). He is present in every community that puts his teachings into practice. He chastises the Jew hater who pretends to be a full gospel Israel lover, who really is just spiritually obese, bored, stubborn and frustrated. He is present even in a very small community such as the family or a group of friends or companions at work. In fact, two or three persons are enough, when united in his name (see Mt. 18:20). When we pray, united in this way, he is present. And it is his presence that makes our petition efficacious. Since his presence assists and helps those who proclaim him to the people, this is true for us, too, who are called to give witness to him.

Don't be 'scared' but, "Fear not, little flock; for it is your Father's good pleasure to give you the kingdom." Luke 12:32.

Only the unforgiving, unrepentant and stubborn stiff necked and iron browed need to fear as they attempt to 'play' church. Hard words indeed, but Jesus has done everything to keep us from the Great White Throne Judgement with his Blood. Under His Blood, there is no fear but only courageous faith which pursues the devil and demons as they run for cover.

http://www.revelationillustrated.com/shop/image30.asp

Kabbalah was not orginally a part of Judaism. I understood better when I realized this. It is occultic and so I never could see it as coming from God.

It did not come into Judaism until around 1100 as a practice. And yes...from what I have read....it is from Babylon.

That right there speaks volumes about how we should feel about it.

Here is a post of mine that I had on the subject in another forum...



Okay....it does have ancient roots....but not necessarily in Judaism to begin with. This is more helpful and explains why I view it the way I do.

Very interesting.

Healthy fear...Yes...healthy fear. No voice, we shouldn't fear when we are walking in truth and light.
If however, we are nearing the DMZ, then a healthy fear and knowledge of God's word should start ringing the alarm bell in our heart.

Thanks CG...Good report. Even though it may not have manifest in a worldly sense until the dates you mentioned, it has been laced into Judaism since the captivity. I agree, it's roots weren't in Judaism... They learned it from their captors and their long influence.

All of the religious stuff of Babylon branched out to become what Christians still battle today. Keeping focused on God alone and his plan for redemption of fallen man. Jesus Christ.

Satan had something to offer when he rebelled from God. He didn't leave empty handed. He's still offering up today what he offered up then. It's just whether you want to bite of not.

Is The Lord speaking through Shekel to bring this message to the Jewish people today and those who have ears to hear? Those who may have unwittingly crossed the line. Or even those who know they've crossed the line and continue on anyway...Those are the ones who will see their own demise coming via the hand on the wall. Yes, I believe he is speaking through Shekel...for exactly the reasons he has stated through out his website.



Yep...That's the ripe virus l was speaking of...Like herpes it lingers in the body waiting for the right conditions to manifest itself. With no light of it's own it must come out from beneath the rocks to warm itself like the cold blooded serpent it is.



What a crock this is in the face of Jesus Christs shed blood. If you are into this stuff shake it off and repent while there's still time left. Get on your face before God and beg for mercy.

However most people, once they bite, like what they find and know. They continue on in knowledge, blinded by the obvious... resting in their own skills and the wisdom of what they think they've found.
Woe is you! Time finally comes to an end and the devils got all the cards...Jesus isn't even at the table. It's just you and the man in black. Make you mad? Well then the Love of God isn't in you.

http://www.carm.org/kabbalah/history.htm

The Origins and History of Kabbalah



Kabbalah claims a divine authorship, though it probably originated in the 12th century A.D. Allegedly, the truth of Kabbalah was first given to the angels before God created the world. Mankind then received it on three separate occasions through three different men. Adam was the first to receive the teaching through the Archangel Raziel as Adam and Eve were expelled from the Garden of Eden. But, because people were more interested in the ways of the world than the things of God, the truth of Kabbalah was eventually lost. It is said that Kabbalah is derived from ancient Hebraic priesthood practices that has the goal of human transformation.1
Abraham (around 1700 B.C.) was the second to receive the truth of Kabbalah. Abraham was supposedly initiated into Kabbalistic mysticism by Melchizedek. Kabbalah was part of the covenant that God made with Abraham. After his descendents became enslaved in Egypt, Kabbalah was once again lost.
The third and final revelation of Kabbalah was given to Moses when he went to Mount Sinai to meet God. The first time Moses went up he received the 10 Commandments. The second time he went up he received the Kabbalah.2 "When Torah was transmitted to Moses, myriads of celestial angels came to scorch him with flames from their Mouths, but the blessed Holy One sheltered him."3
Kabbalists refer to the Mosaic encounters as the outer and inner teaching. The first encounter of Moses with God is when he received the 10 Commandments. This is called the outer teaching. It was upon the second encounter with God that Moses received the Kabbalistic truths. This is referred to as the inner teaching.
Throughout history, Kabbalists have chosen to keep their esoteric interpretations of the Torah hidden from the general populace and religious leaders of the day. Many of the Kabbalists were persecuted and many others knew that their teachings contradicted accepted Jewish and Christian theologies. Therefore, they practiced a self-imposed silence.
Nevertheless, Kabbalah survived and was passed down through the centuries. Originally, only Jewish men who were at least 40 years old could study Kabbalah. But later this restriction was abandoned by many people.
The earliest documented Kabbalistic writing is called the Sepher Yetzirah, or the book of formation. One tradition is that Abraham wrote the book, placed it in a cave, and it was discovered later and published as the Sepher Yetzirah. Another tradition says that the Rabbi Akiva wrote it. He is supposed to be one of the greatest Kabbalists of all time.
Moses De Leon, a 14th century Spanish Kabbalist presented the Zohar, an extremely influential book in Kabbalistic philosophy. De Leon originally claimed that he found the scrolls that have been written much earlier, more than a thousand years earlier. Recent scholarship supports the idea that he is the one who wrote the Zohar.
Present-day Kabbalah is said to have descended through John Dee (1527-1608) who was a mathematician and geographer and Isaac Luria (1534-1572) who he is commonly referred to as the greatest Kabbalist of modern times. Contributers were Chayim Vital (1543-1620), Shabbetai Zvi (1626-1676), Gaon of Vilna ( 1720-1797), Rabbi Ashlag (1886-1955), and others.

Today

Today Kabbalah has become popularized by such writers as Yehuda Berg and spread by the internet and TV. Many traditional Jewish cabalists condemn contemporary Kabbalah movements as fanciful and overly popularized misrepresentations of authentic Kabbalistic philosophy. Whichever the case, today's Kabbalah is definitely more new age than biblical. Even though modern popularized Kabbalah has been condemned by traditional cabalists, readings from the Zohar, which is several hundred years old and is at the heart of Kabbalah, reveals theology reminiscent of the new age: reincarnation, inner divinity, pantheism, etc.
The truth is that Kabbalah has evolved. But it has evolved from one heresy deeper into another. It is not biblical and it is not true.


__________________
References

1.

Leet, Leonora., The Secret Doctrine of the Kabbalah. Rochester Vermont: Inner Traditions, 1999. p. 2
2.

Hopking, C.J.M., The Practical Kabbalah Guidebook. New York, New York: Sterling Publishing Co. 2001. p. 8
3.

The Zohar, http://www.sup.org/zohar/ p. 27

http://jesus-messiah.com/html/greek-3.html


The Cabalist Jewish Connection

By Cohen G. Reckart, Pastor

What is missed by the majority of researchers of the trinity doctrine, is the educational and Jewish influence upon Athanasius. Athanasius was from Alexandria, a learning center heavily populated by Jews who had Hellenized, and who had adopted a Babylonian Gnostic re-interpretation of the Old Testament. It is well recognized that the Jews played a major role in fertilizing the world with their own brand of Greek Gnosticism, that included a secret belief in a trinity of Kether [first elohim], Hokhmah [second elohim], and Binah [third elohim] (16). That Kabbalism is Gnosticism, I have only to quote the most eminent scholar and Kabbalist of the twentieth century: "Behind the whole stands the living personality of a mystic who, starting with the philosophical and Talmudic education of his time, lets himself be ever more deeply drawn to the mystical and gnostic ideas of the Kabbalah" (17).

It is from the Kabbalah often also called the Quabbalah, that the trinitarian and pluralistic use of "echad" the Hebrew word for "one", is said by the mystics to mean "unity" rather than an absolute oneness. I have challenged this heresy for several years. For instance, the trinitarians and the Jewish mystics, including many Jewish Messianic Rabbis, will say that the Hebrew word "Elohim" is a plural of unity compromising three separate persons in the trinity, namely: the Father, the Son, and the Holy Ghost. These neo-Plato philosophers, corrupting the intent of the Word of God that there is one God, now saying that both the Hebrew word "Elohim" and "echad" means "unity". Well then, if these in this heresy believe this doctrine why then do they balk and hesitate to translate "Elohim" as "Gods" plural rather than in the singular "God"? Why then do they not likewise translate "echad" as "three" and not rather as "one"? Obviously such distortions would wreck the entire text of the Bible from lid to lid and these men of alleged great esteem are not ready to take that wrecking -ball upon the sacred text. The concept of a unity in a trinity or even more gods, has its roots within the ancient Jewish traditions of the Kabbalah, known in the days of Jesus Messiah as "THE TRADITIONS OF THE ELDERS." And, did Jesus validate these traditions as truth or of having within them the sacred revelations of God? And if he did not, what does this say of those alleged scholars and Bible teachers who take their trinitarian cue from Plato or these nefarious traditions?

If we were to translate "Elohim" as "Gods" since they say it is plural and means more than one person that are all equally God, and if we translate "echad" as "three" instead of the "One" as they teach it for doctrine, what would this heresy do to Deut 6:4?:

"Hear ,O Israel: the Lord our God is one Lord."

Hear, O Israel: the Lords our Gods are three Lords!

And: In the beginning Gods created the heavens and the earth, and Thou shalt have no other Gods before us! Does not the first Commandment prohibit a plural view or pluralistic practice of worship of God?

Jewish Kabbalahism has been the secret lodge of the trinity doctrine since the days of Babylonian captivity. Even prior to that eviction from the Holy land, the Jews worshiped a trinity in the form of "Baal, Ashtoreth, and Tammuz." So the trinity is not new to them, nor is it new that Jews would believe in a trinity of gods. Elijeh confronted the trinitarians on Mount Carmel. And after this encounter, the Prophets have each in their generations and in their Ministries stood firm against the trinity doctrine of the pagans and any adoption of it to be applied to God. The trinity did not begin in Nicaea, it was just adopted from paganism at that time as an explanation of the relationship of the three gods: the Father, the Son and the Holy Ghost to the former two.

How did the trinity come from Babylon to Egypt and then to Nicaea in 325AD? We shall now see the genealogy of the cult doctrine that has so many millions in bondage and captivity came through Jewish mysticism known as the Kabballah. Many are unlearned of this connection and because of it are blinded and remain lost without salvation in the cults of the trinitarians.

The Genealogy of the trinity from apostate Judaism:

Jews had settled in Alexandria from the time of Jeremiah. They held high positions in civic affairs, but mostly as educators. According to David M. Scholer, there were over a million Jews in Alexandria at the time of Philo (18). Philo Judaeaus, is perhaps the most celebrated Jewish Gnostic-mystic of the Christian era, being a contemporary of Christ and the Apostles. His daughter Bernice, was the wife of Herod Agrippa, who tried the Apostle Paul. Philo is recognized as the first who "openly" applied Babylonian and Greek methods of mysticism, in an allegorical re-interpretation of the Scriptures (19). He considered the Greek philosophers on the same level as the Prophets. He believed their logic, reasonings, and hypostasis were divine in origin. Later, so did the Roman and Greek Orthodox Catholics. Many Jews, following Philo's beliefs, Hellenized, and adopted the trinity concept of Plato and applied it to their God. This Gnosticism is known as Cabalism, the spiritual and metaphysical strength of the Babylonian and Jerusalem Talmuds. Few know that behind Jewish mysticism is the secret belief in a triad of gods in interlocking trinities. These powers or elohims are pictured in the ten emanations of the Sefiroth, or tree of life, in Cabalism. This mysticism invalidates the literal meaning and interpretation of the Scriptures. Among Apostolics we call this "spiritualizing." In fact, "Christian spiritualizing" is mysticism, using private re-interpretation as a claim to invalidate the literal meaning and interpretation of Scripture. The trinity doctrine is birthed out of mysticism, not revelation. Out of this "spiritualizing and mysticism" comes the theory of the hidden trinity in God, that must come by "special" revelation through philosophy.

From Philo [20BC-50AD], to Athanasius [293AD-373AD], roughly 275 years, the Greek-Plato fermentation concerning God had reached its intellectual peak in Egypt. Judaism had fully molded to Platonism. Now it was time for the Christian Church to be molded. Would it reject Greek paganism, or philosophy as Apostle Paul called it [Col. 2:8]? Certainly we might question, that since Platonism was well known by Paul and the Apostles, why, if it was truth, that they rejected it and it took another 275 years for it to be accepted at Nicaea? Did God miss something here? Were his Apostles not led of the Spirit but those at Nicaea were?

Athanasius, the thirty two year old, archdeacon of Bishop Alexander, and the replacement of the aged Arius, championed Platonism, and fully impregnated the Roman and Greek Churches with it. "He received a liberal education. From early years he was instructed in Scriptures, that is the Septuagint and New Testament. He knew no Hebrew. These studies, combined with Greek learning, molded his later thought. In mind and outlook he was a through Greek. There was nothing of the native Egyptian about him" (20)

Athanasius was a Greek philosopher inside the pre-Nicaea Roman and Greek Churches. He did not accidentally come up with the Plato theory of godhead as his revelation, he learned it at the university where he studied and applied it brilliantly to the Scriptures as none before him. His genius and diplomatic power were assets around the old-heads at Nicaea, most who were unlearned, and some we might term today as liberals [so lose they don't believe fat meat is greasy]. How could a thirty two year old unknown archdeacon, come to such political strength behind closed doors, to cause 316 of 318 old grey-haired Bishops to fall for his Greek re-interpretation of monotheism [the Monarchy]? Could it be that Greek philosophy had already nearly deceived the Bishops that attended, through the writings of Clement, Irenaeus, Tertullian, et al? It must be said that the Monotheistic beliefs of the early Apostles and Christians, was firmly that there was one God and one person in the Godhead. This is verified by the following Scriptures, and the fact that the word "trinity" is not in the Bible:

MAL 2:10
10a: Have we not all one father? hath not one God created us?

MAR 12:32
32: And the scribe said unto him, Well, Master, thou hast said the truth: for there is one God; and there is none other but he.

ROM 3:30
30: Seeing it is one God, which shall justify the circumcision by faith, and uncircumcision through faith.

EPH 4:6
6: One God and Father of all, who is above all, and through all, and in you all.

1TI 2:5
5: For there is one God, and one mediator between God and men, the man Christ Jesus.

JAM 2:19
19: Thou believest that there is one God; thou doest well: the devils also believe, and tremble [the devil does not believe in three gods, he ought to know, he was there].

1TI 3:16
16: And without controversy great is the mystery of godliness: God was manifest in the flesh [as Jesus Christ], justified in the Spirit [to still be God], seen of angels [in heaven], preached unto the Gentiles [when on earth], believed on in the world [as God by Christians], received up into glory [back to his throne].

The Greek Orthodox deny that these Scriptures prove there is one God the Father; that God is one person; that God came to earth in the fleshly form as Jesus Christ; that we are to believe upon Jesus that he is Almighty God; and that he went back to heaven; from whence he will return in the last day for his people as GOD. That he is the great God and Saviour, both at the same time, who will come back from heaven, we have only to quote one verse of Scripture:

--- 2:13
13: Looking for that blessed hope [the rapture], and the glorious appearing of the great God and our Saviour Jesus Christ.

Is not then the trinity doctrine, the fruit of the Nico-Latin seed, that grew in the fertile soil of Greek gnosticism, that tried to infiltrate the Church at Pergamos? Is not the acceptance of the trinity doctrine a proof that Greek Orthodoxy is a form of Hellenized Christian Gnosticism, and not the true Orthodox Apostolic Church at all? If the trinity doctrine was such a fact, why did it take 295 years before it become an established Church doctrine, in 325 AD at Nicaea?

I would urge Christian and Apostolic researchers not to minimize the Jewish-Greek-Gnostic influence, Athanasius wielded at Nicaea, and the fact that he learned the trinity doctrine from the two sources of Hellenized Judaism [Cabalism], and Plato philosophy. Those researching the trinity usually fail to make discovery of the bridge and route of the trinity doctrine from Babylon to Jerusalem to Greece to Alexandria and then to Nicaea. The genealogy is very clear to those who research the background life of Athanasius back to Philo.

_________________________________________

Bibilography

(16) Charles Ponce, Kabbalah, p 111
(17) Zohar, The Book Of Splendor, Gershom Scholem, Introduction, p 15
(18) C. D. Youge, The Works Of Philo, Foreward, p xii
(19) Ibid, p xiii
(20) Encyclopedia Britannica, 1958 Edition, Vol. 2, p 597.



It's wonderful to be saved and to know it.
I'm so glad you also know Jesus as your Lord and Savior. Together we shall pray for
these misguided souls who need to come under the blood of Christ.

Maranatha Miki, the joy of the Lord is your strength!
Praise Jesus Christ and the fountain of Divine Blood we are saved by.

I don't believe that for one second.

But now this sounds more like it!




Thanks voice!